PPM1J Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12844T
Artikelname: PPM1J Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12844T
Hersteller Artikelnummer: CNA12844T
Alternativnummer: MBL-CNA12844T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-260 of human PPM1J (NP_005158.5).
Konjugation: Unconjugated
Alternative Synonym: PP2CZ, PPP2CZ, PP2Czeta, PP2C-zeta
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 333926
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAVENAFQLMDEQMARERRGHQVEGGC
Target-Kategorie: PPM1J
Application Verdünnung: WB: WB,1:500 - 1:2000