SLC7A9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12848T
Artikelname: SLC7A9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12848T
Hersteller Artikelnummer: CNA12848T
Alternativnummer: MBL-CNA12848T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1).
Konjugation: Unconjugated
Alternative Synonym: BAT1, CSNU3
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 11136
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL
Target-Kategorie: SLC7A9
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200