SULT1A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12851T
Artikelname: SULT1A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12851T
Hersteller Artikelnummer: CNA12851T
Alternativnummer: MBL-CNA12851T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human SULT1A2 (NP_001045.1).
Konjugation: Unconjugated
Alternative Synonym: STP2, HAST4, P-PST, ST1A2, TSPST2, P-PST 2
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 6799
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Target-Kategorie: SULT1A2
Application Verdünnung: WB: WB,1:500 - 1:2000