TP53I11 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12855T
Artikelname: TP53I11 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12855T
Hersteller Artikelnummer: CNA12855T
Alternativnummer: MBL-CNA12855T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TP53I11 (NP_001245249.1).
Konjugation: Unconjugated
Alternative Synonym: PIG11
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 9537
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA
Target-Kategorie: TP53I11
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100