HLA-B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1285T
Artikelname: HLA-B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1285T
Hersteller Artikelnummer: CNA1285T
Alternativnummer: MBL-CNA1285T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-B (NP_005505.2).
Konjugation: Unconjugated
Alternative Synonym: AS, HLAB, B-4901
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 3106
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
Target-Kategorie: HLA-B
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200