TLX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12861T
Artikelname: TLX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12861T
Hersteller Artikelnummer: CNA12861T
Alternativnummer: MBL-CNA12861T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TLX1 (NP_001182446.1).
Konjugation: Unconjugated
Alternative Synonym: TCL3, HOX11
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 3195
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTG
Target-Kategorie: TLX1
Application Verdünnung: WB: WB,1:1000 - 1:2000