SLC17A7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12879P
Artikelname: SLC17A7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12879P
Hersteller Artikelnummer: CNA12879P
Alternativnummer: MBL-CNA12879P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP_064705.1).
Konjugation: Unconjugated
Alternative Synonym: BNPI, VGLUT1
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 57030
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: KHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY
Target-Kategorie: SLC17A7
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200