ADPRM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12883T
Artikelname: ADPRM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12883T
Hersteller Artikelnummer: CNA12883T
Alternativnummer: MBL-CNA12883T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 203-342 of human ADPRM (NP_064618.3).
Konjugation: Unconjugated
Alternative Synonym: MDS006, C17orf48, NBLA03831
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 56985
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC
Target-Kategorie: ADPRM
Application Verdünnung: WB: WB,1:500 - 1:2000