CLN5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12886T
Artikelname: CLN5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12886T
Hersteller Artikelnummer: CNA12886T
Alternativnummer: MBL-CNA12886T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 96-407 of human CLN5 (NP_006484.1).
Konjugation: Unconjugated
Alternative Synonym: CLN5,NCL
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 1203
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLP
Target-Kategorie: CLN5
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200