FCER1G Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12889T
Artikelname: FCER1G Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12889T
Hersteller Artikelnummer: CNA12889T
Alternativnummer: MBL-CNA12889T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1).
Konjugation: Unconjugated
Alternative Synonym: FCRG
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 2207
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Target-Kategorie: FCER1G
Application Verdünnung: WB: WB,1:1000 - 1:2000