DKC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12914T
Artikelname: DKC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12914T
Hersteller Artikelnummer: CNA12914T
Alternativnummer: MBL-CNA12914T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human DKC1 (NP_001354.1).
Konjugation: Unconjugated
Alternative Synonym: DKC, CBF5, DKCX, NAP57, NOLA4, XAP101
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 1736
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGAL
Target-Kategorie: DKC1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100