Rap1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12925T
Artikelname: Rap1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12925T
Hersteller Artikelnummer: CNA12925T
Alternativnummer: MBL-CNA12925T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human Rap1B (NP_056461.1).
Konjugation: Unconjugated
Alternative Synonym: K-REV, RAL1B
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 5908
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL
Target-Kategorie: RAP1B
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200