TAL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA12927T
| Artikelname: |
TAL1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA12927T |
| Hersteller Artikelnummer: |
CNA12927T |
| Alternativnummer: |
MBL-CNA12927T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 242-331 of human TAL1 (NP_003180.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
SCL, TCL5, tal-1, bHLHa17 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
34kDa |
| NCBI: |
6886 |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
LLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR |
| Target-Kategorie: |
TAL1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
