YY1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12928T
Artikelname: YY1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12928T
Hersteller Artikelnummer: CNA12928T
Alternativnummer: MBL-CNA12928T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human YY1 (NP_003394.1).
Konjugation: Unconjugated
Alternative Synonym: DELTA, NF-E1, UCRBP, GADEVS, INO80S, YIN-YANG-1
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 7528
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSG
Target-Kategorie: YY1
Application Verdünnung: WB: WB,1:500 - 1:1000|ChIP,1:50 - 1:200