VAPA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12939T
Artikelname: VAPA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12939T
Hersteller Artikelnummer: CNA12939T
Alternativnummer: MBL-CNA12939T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 137-227 of human VAPA (NP_919415.2).
Konjugation: Unconjugated
Alternative Synonym: VAP-A, VAP33, VAMP-A, VAP-33, hVAP-33
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 9218
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSP
Target-Kategorie: VAPA
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200