ATP6V1D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12940T
Artikelname: ATP6V1D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12940T
Hersteller Artikelnummer: CNA12940T
Alternativnummer: MBL-CNA12940T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-247 of human ATP6V1D (NP_057078.1).
Konjugation: Unconjugated
Alternative Synonym: VATD, VMA8, ATP6M
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 51382
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
Target-Kategorie: ATP6V1D
Application Verdünnung: WB: WB,1:500 - 1:2000