[KO Validated] CDK7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12942T
Artikelname: [KO Validated] CDK7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12942T
Hersteller Artikelnummer: CNA12942T
Alternativnummer: MBL-CNA12942T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1).
Konjugation: Unconjugated
Alternative Synonym: CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 1022
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Target-Kategorie: CDK7
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200