COMT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1294S
Artikelname: COMT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1294S
Hersteller Artikelnummer: CNA1294S
Alternativnummer: MBL-CNA1294S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-221 of human COMT (NP_009294.1).
Konjugation: Unconjugated
Alternative Synonym: HEL-S-98n
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 1312
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Target-Kategorie: COMT
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:100