PGK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12952T
Artikelname: PGK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12952T
Hersteller Artikelnummer: CNA12952T
Alternativnummer: MBL-CNA12952T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 242-360 of human PGK2 (NP_620061.2).
Konjugation: Unconjugated
Alternative Synonym: PGKB, PGKPS, HEL-S-272, dJ417L20.2
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 5232
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
Target-Kategorie: PGK2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100