p63 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12960T
Artikelname: p63 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12960T
Hersteller Artikelnummer: CNA12960T
Alternativnummer: MBL-CNA12960T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human p63 (NP_003713.3).
Konjugation: Unconjugated
Alternative Synonym: AIS, KET, LMS, NBP, RHS, p40, p51, p63, EEC3, OFC8, p73H, p73L, SHFM4, TP53L, TP73L, p53CP, TP53CP, B(p51A), B(p51B)
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 8626
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALS
Target-Kategorie: TP63
Application Verdünnung: WB: WB,1:1000 - 1:2000