MARCH8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12962T
Artikelname: MARCH8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12962T
Hersteller Artikelnummer: CNA12962T
Alternativnummer: MBL-CNA12962T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 232-291 of human MARCH8 (NP_659458.2).
Konjugation: Unconjugated
Alternative Synonym: MIR, CMIR, c-MIR, MARCH8, RNF178, MARCH-VIII
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 220972
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV
Target-Kategorie: MARCHF8
Application Verdünnung: WB: WB,1:500 - 1:2000