PITPNA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12966T
Artikelname: PITPNA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12966T
Hersteller Artikelnummer: CNA12966T
Alternativnummer: MBL-CNA12966T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 211-270 of human PITPNA (NP_006215.1).
Konjugation: Unconjugated
Alternative Synonym: PITPN, VIB1A, HEL-S-36, PI-TPalpha
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 5306
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Target-Kategorie: PITPNA
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200