p63 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA12968T
| Artikelname: |
p63 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA12968T |
| Hersteller Artikelnummer: |
CNA12968T |
| Alternativnummer: |
MBL-CNA12968T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human p63 (NP_003713.3). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
AIS, KET, LMS, NBP, RHS, p40, p51, p63, EEC3, OFC8, p73H, p73L, SHFM4, TP53L, TP73L, p53CP, TP53CP, B(p51A), B(p51B) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
77kDa |
| NCBI: |
8626 |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALS |
| Target-Kategorie: |
TP63 |
| Application Verdünnung: |
WB: WB,1:1000 - 1:2000 |
