p63 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA12968T
Artikelname: |
p63 Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA12968T |
Hersteller Artikelnummer: |
CNA12968T |
Alternativnummer: |
MBL-CNA12968T |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human p63 (NP_003713.3). |
Konjugation: |
Unconjugated |
Alternative Synonym: |
AIS, KET, LMS, NBP, RHS, p40, p51, p63, EEC3, OFC8, p73H, p73L, SHFM4, TP53L, TP73L, p53CP, TP53CP, B(p51A), B(p51B) |
Klonalität: |
Polyclonal |
Molekulargewicht: |
77kDa |
NCBI: |
8626 |
Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
Sequenz: |
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALS |
Target-Kategorie: |
TP63 |
Application Verdünnung: |
WB: WB,1:1000 - 1:2000 |