SLC12A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12999T
Artikelname: SLC12A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12999T
Hersteller Artikelnummer: CNA12999T
Alternativnummer: MBL-CNA12999T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SLC12A1 (NP_000329.2).
Konjugation: Unconjugated
Alternative Synonym: BSC, BSC1, CCC2, BSC-1, NKCC2
Klonalität: Polyclonal
Molekulargewicht: 121kDa
NCBI: 6557
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSAD
Target-Kategorie: SLC12A1
Application Verdünnung: WB: WB,1:500 - 1:2000