CD40L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13002T
Artikelname: CD40L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13002T
Hersteller Artikelnummer: CNA13002T
Alternativnummer: MBL-CNA13002T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 79-129 of human CD40L (NP_000065.1).
Konjugation: Unconjugated
Alternative Synonym: IGM, IMD3, TRAP, gp39, CD154, CD40L, HIGM1, T-BAM, TNFSF5, hCD40L
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 959
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNPQIAAHVISE
Target-Kategorie: CD40LG
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200