AKR1C1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13004T
Artikelname: AKR1C1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13004T
Hersteller Artikelnummer: CNA13004T
Alternativnummer: MBL-CNA13004T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C1 (NP_001344.2).
Konjugation: Unconjugated
Alternative Synonym: C9, DD1, DDH, DDH1, H-37, HBAB, MBAB, HAKRC, DD1/DD2, 2-ALPHA-HSD, 20-ALPHA-HSD
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 1645
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL
Target-Kategorie: AKR1C1
Application Verdünnung: WB: WB,1:1000 - 1:3000