HDAC7 Rabbit mAb, Clone: [ARC0713], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA13008S
Artikelname: HDAC7 Rabbit mAb, Clone: [ARC0713], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA13008S
Hersteller Artikelnummer: CNA13008S
Alternativnummer: MBL-CNA13008S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-198 of human HDAC7 (Q8WUI4).
Konjugation: Unconjugated
Alternative Synonym: HD7, HD7A, HDAC7A
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0713]
Molekulargewicht: 103kDa
NCBI: 51564
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSS
Target-Kategorie: HDAC7
Application Verdünnung: WB: WB,1:500 - 1:1000