CEL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13011T
Artikelname: CEL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13011T
Hersteller Artikelnummer: CNA13011T
Alternativnummer: MBL-CNA13011T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-550 of human CEL (NP_001798.2).
Konjugation: Unconjugated
Alternative Synonym: BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 1056
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYL
Target-Kategorie: CEL
Application Verdünnung: WB: WB,1:500 - 1:2000