CSNK1G3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13013T
Artikelname: CSNK1G3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13013T
Hersteller Artikelnummer: CNA13013T
Alternativnummer: MBL-CNA13013T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 304-423 of human CSNK1G3 (NP_001026982.1).
Konjugation: Unconjugated
Alternative Synonym: CSNK1G3L, CKI-gamma 3
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 1456
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQRHK
Target-Kategorie: CSNK1G3
Application Verdünnung: WB: WB,1:500 - 1:2000