Neutrophil Elastase (ELANE) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13015P
Artikelname: Neutrophil Elastase (ELANE) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13015P
Hersteller Artikelnummer: CNA13015P
Alternativnummer: MBL-CNA13015P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 168-267 of human Neutrophil Elastase (ELANE) (NP_001963.1).
Konjugation: Unconjugated
Alternative Synonym: GE, NE, HLE, HNE, ELA2, SCN1, PMN-E
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 1991
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Target-Kategorie: ELANE
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200