PROX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13042T
Artikelname: PROX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13042T
Hersteller Artikelnummer: CNA13042T
Alternativnummer: MBL-CNA13042T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-375 of human PROX1 (NP_002754.2).
Konjugation: Unconjugated
Alternative Synonym: PROX1
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 5629
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SFQQLVSARKEQKREERRQLKQQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMRSEILDARAQDSVGRSDNEMCELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETLKQELNTAMSQVVDTVVKVFSAKP
Target-Kategorie: PROX1
Application Verdünnung: WB: WB,1:500 - 1:1000