MAPK12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13046T
Artikelname: MAPK12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13046T
Hersteller Artikelnummer: CNA13046T
Alternativnummer: MBL-CNA13046T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 248-367 of human MAPK12 (NP_002960.2).
Konjugation: Unconjugated
Alternative Synonym: ERK3, ERK6, ERK-6, SAPK3, PRKM12, SAPK-3, MAPK 12, P38GAMMA
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 6300
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Target-Kategorie: MAPK12
Application Verdünnung: WB: WB,1:2000 - 1:5000