SORL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13047T
Artikelname: SORL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13047T
Hersteller Artikelnummer: CNA13047T
Alternativnummer: MBL-CNA13047T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2065-2214 of human SORL1 (NP_003096.1).
Konjugation: Unconjugated
Alternative Synonym: LR11, LRP9, SORLA, gp250, SorLA-1, C11orf32
Klonalität: Polyclonal
Molekulargewicht: 248kDa
NCBI: 6653
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA
Target-Kategorie: SORL1
Application Verdünnung: WB: WB,1:500 - 1:1000