SREBP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13049S1
Artikelname: SREBP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13049S1
Hersteller Artikelnummer: CNA13049S1
Alternativnummer: MBL-CNA13049S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 155-310 of human SREBF2 (NP_004590.2).
Konjugation: Unconjugated
Alternative Synonym: SREBP2, bHLHd2, SREBP-2
Klonalität: Polyclonal
Molekulargewicht: 124kDa
NCBI: 6721
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: TFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILTTMPVMMGQEK
Target-Kategorie: SREBF2
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200