TBCA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13050T
Artikelname: TBCA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13050T
Hersteller Artikelnummer: CNA13050T
Alternativnummer: MBL-CNA13050T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TBCA (NP_004598.1).
Konjugation: Unconjugated
Alternative Synonym: TBCA
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 6902
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Target-Kategorie: TBCA
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200