ITGA8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13056T
Artikelname: ITGA8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13056T
Hersteller Artikelnummer: CNA13056T
Alternativnummer: MBL-CNA13056T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 907-1000 of human ITGA8 (NP_003629.2).
Konjugation: Unconjugated
Alternative Synonym: ITGA8
Klonalität: Polyclonal
Molekulargewicht: 117kDa
NCBI: 8516
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALASLVSFEVKKMPYTDQPAKLPEGSIVIKTSVI
Target-Kategorie: ITGA8
Application Verdünnung: WB: WB,1:500 - 1:2000