AP3D1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13058T
Artikelname: AP3D1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13058T
Hersteller Artikelnummer: CNA13058T
Alternativnummer: MBL-CNA13058T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human AP3D1 (NP_003929.4).
Konjugation: Unconjugated
Alternative Synonym: ADTD, HPS10, hBLVR
Klonalität: Polyclonal
Molekulargewicht: 130kDa
NCBI: 8943
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVE
Target-Kategorie: AP3D1
Application Verdünnung: WB: WB,1:500 - 1:2000