MPZL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13059T
Artikelname: MPZL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13059T
Hersteller Artikelnummer: CNA13059T
Alternativnummer: MBL-CNA13059T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 195-269 of human MPZL1 (NP_003944.1).
Konjugation: Unconjugated
Alternative Synonym: PZR, PZRa, PZRb, PZR1b, MPZL1b
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 9019
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Target-Kategorie: MPZL1
Application Verdünnung: WB: WB,1:500 - 1:2000