BET1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13069T
Artikelname: BET1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13069T
Hersteller Artikelnummer: CNA13069T
Alternativnummer: MBL-CNA13069T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human BET1 (NP_005859.1).
Konjugation: Unconjugated
Alternative Synonym: HBET1
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 10282
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQT
Target-Kategorie: BET1
Application Verdünnung: WB: WB,1:500 - 1:2000