[KO Validated] IFITM3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13070T
Artikelname: [KO Validated] IFITM3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13070T
Hersteller Artikelnummer: CNA13070T
Alternativnummer: MBL-CNA13070T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human IFITM3 (NP_066362.2).
Konjugation: Unconjugated
Alternative Synonym: 1-8U, IP15, DSPA2b
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 10410
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Target-Kategorie: IFITM3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100