VPS39 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13082T
Artikelname: VPS39 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13082T
Hersteller Artikelnummer: CNA13082T
Alternativnummer: MBL-CNA13082T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 606-875 of human VPS39 (NP_056104.2).
Konjugation: Unconjugated
Alternative Synonym: TLP, VAM6, hVam6p
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 23339
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEYRQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAEEYCHKHYDRNKDGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPKANLQAALQVLELHHSKLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNG
Target-Kategorie: VPS39
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200