TWEAKR/Fn14/CD266 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13093T
Artikelname: TWEAKR/Fn14/CD266 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13093T
Hersteller Artikelnummer: CNA13093T
Alternativnummer: MBL-CNA13093T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 28-129 of human TWEAKR/Fn14/CD266 (NP_057723.1).
Konjugation: Unconjugated
Alternative Synonym: FN14, CD266, TWEAKR
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 51330
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Target-Kategorie: TNFRSF12A
Application Verdünnung: WB: WB,1:500 - 1:2000