SF3B6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13097T
Artikelname: SF3B6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13097T
Hersteller Artikelnummer: CNA13097T
Alternativnummer: MBL-CNA13097T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human SF3B6 (NP_057131.1).
Konjugation: Unconjugated
Alternative Synonym: P14, Ht006, SAP14, SAP14a, SF3B14, CGI-110, HSPC175, SF3B14a
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 51639
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Target-Kategorie: SF3B6
Application Verdünnung: WB: WB,1:500 - 1:2000