YY1AP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13104T
Artikelname: YY1AP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13104T
Hersteller Artikelnummer: CNA13104T
Alternativnummer: MBL-CNA13104T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YY1AP1 (NP_060723.2).
Konjugation: Unconjugated
Alternative Synonym: GRNG, HCCA1, HCCA2, YY1AP
Klonalität: Polyclonal
Molekulargewicht: 88kDa
NCBI: 55249
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQT
Target-Kategorie: YY1AP1
Application Verdünnung: WB: WB,1:500 - 1:2000