GKN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13107T
Artikelname: GKN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13107T
Hersteller Artikelnummer: CNA13107T
Alternativnummer: MBL-CNA13107T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-185 of human GKN1 (NP_062563.3).
Konjugation: Unconjugated
Alternative Synonym: FOV, CA11, AMP18, BRICD1, foveolin
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 56287
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVL
Target-Kategorie: GKN1
Application Verdünnung: WB: WB,1:500 - 1:2000