HFE Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1310S
Artikelname: HFE Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1310S
Hersteller Artikelnummer: CNA1310S
Alternativnummer: MBL-CNA1310S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-306 of human HFE (NP_000401.1).
Konjugation: Unconjugated
Alternative Synonym: HH, HFE1, HLA-H, MVCD7, TFQTL2
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 3077
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV
Target-Kategorie: HFE
Application Verdünnung: WB: WB,1:500 - 1:2000