TSPYL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13118T
Artikelname: TSPYL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13118T
Hersteller Artikelnummer: CNA13118T
Alternativnummer: MBL-CNA13118T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 240-460 of human TSPYL2 (NP_071400.1).
Konjugation: Unconjugated
Alternative Synonym: CDA1, CTCL, NP79, TSPX, CINAP, DENTT, SE204, HRIHFB2216
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 64061
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTD
Target-Kategorie: TSPYL2
Application Verdünnung: WB: WB,1:1000 - 1:2000