RBM26 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13120T
Artikelname: RBM26 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13120T
Hersteller Artikelnummer: CNA13120T
Alternativnummer: MBL-CNA13120T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3).
Konjugation: Unconjugated
Alternative Synonym: ARRS2, SE70-2, ZC3H17, PRO1777, C13orf10, PPP1R132
Klonalität: Polyclonal
Molekulargewicht: 114kDa
NCBI: 64062
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS
Target-Kategorie: RBM26
Application Verdünnung: WB: WB,1:500 - 1:2000