REG4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13129T
Artikelname: REG4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13129T
Hersteller Artikelnummer: CNA13129T
Alternativnummer: MBL-CNA13129T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-158 of human REG4 (NP_114433.1).
Konjugation: Unconjugated
Alternative Synonym: GISP, RELP, REG-IV
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 83998
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Target-Kategorie: REG4
Application Verdünnung: WB: WB,1:500 - 1:1000