SCGB3A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA13137T
Artikelname: SCGB3A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA13137T
Hersteller Artikelnummer: CNA13137T
Alternativnummer: MBL-CNA13137T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human SCGB3A2 (NP_473364.1).
Konjugation: Unconjugated
Alternative Synonym: LU103, PNSP1, UGRP1, pnSP-1
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 117156
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Target-Kategorie: SCGB3A2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200